FANDOM


Thymidylate synthase
Thymidylate synthase coloured by secondary type
3D structure of thymidylate synthase, based on PDB 4H1I.
400px 4H1I
Animated 3D structure of TS based on PDB 4H1I.

Synonyms

Synonyms
Thymidylate synthase, TS, TSase

PDB

Search for UniProt ID P04818.

Example IDs
1JUJ (RCSB, PDBe; X-ray), 1JU6 (RCSB, PDBe; X-ray), 3EJL (RCSB, PDBe; X-ray), 3GG5 (RCSB, PDBe; X-ray)

Proteopedia

Thymidylate synthase

Jmol applet of 4H1I

4H1I.

Residues

312

FASTA

Sequence
PVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

EC number

2.1.1.45

Entrez

7298

MeSH

D013940
Review search.

UniProt

P04818

Thymidylate synthase is an enzyme that catalyses the reaction:[1]

MTHF + dUMP ⇌ dihydrofolate + dTMP

dTMP is then utilized in the synthesis of DNA.


Reference listEdit

  1. "TYMS - Thymidylate Synthase - Homo sapiens (Human)". UniProt. Switzerland, UK, USA: UniProt Consortium. 26 November 2014. Retrieved 9 December 2014. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.