FANDOM


Pyridoxal-kinase
2AJP

Synonyms

N/A

PDB

Search for UniProt ID O00764.

Example IDs

Proteopedia

Pyridoxal-kinase

Jmol applet of 2AJP

2AJP.

No. of amino acids

326

FASTA

Sequence
MGSSHHHHHHSSGLVPRGSRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

MeSH

D011731
Review search.

UniProt

O00764

Entrez

8566

Pyridoxal-kinase catalyses the transfer of phosphate from ATP to 5’ alcohol of pyridoxine (vitamin B6), pyridoxamine and pyridoxal.

External linksEdit

Reference listEdit

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.