FANDOM


Lymphotoxin
Structure of lymphotoxin based on 1TNR
Structure of lymphotoxin based on PDB 1TNR

Synonyms

LTA, Lymphotoxin-alpha, tumour necrosis factor beta (TGF-β)

PDB

Search for UniProt ID P01374.

Example IDs

Proteopedia

N/A

Jmol applet of 1TNR

[1]

No. of amino acids

205

FASTA

Sequence
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

MeSH

D008233
Review search.

UniProt

P01374

Entrez

4049

Lymphotoxin is a cytokine that induces apoptosis in multiple cancer cell lines. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.