FANDOM


Interleukin-9


Synonyms

IL-9, cytokine P40, T-cell growth factor P40

PDB

Search for UniProt ID P15248.

Example IDs
None for human IL-9

Proteopedia

N/A

Jmol applet of

N/A

No. of amino acids

117

FASTA

Sequence
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

MeSH

D016906

UniProt

P15248

Entrez

3578

Interleukin-9 is produced by TH2 cells, regulates allergic inflammatory responses, promotes the differentiation and growth of mast cells and supports IL-2/IL-4-independent growth of helper T-cells, although its effects on these cells is limited compared to IL-2 and IL-4.[1][2] It also stimulates IgG and IgE production from IL-4-stimulated B cells.[1] May play a role in oncogenesis and autoimmune diseases.[3][4]



External linksEdit

Reference listEdit

  1. 1.0 1.1 Goswami, R; Kaplan, MH (15 March 2011). "A brief history of IL-9.". Journal of Immunology 186 (6): 3283–8. PMC 3074408. PMID 21368237. doi:10.4049/jimmunol.1003049. 
  2. "Interleukin-9". Medical Subject Headings. Bethesda, USA: U.S. National Library of Medicine. 2011. Retrieved 2 November 2014. 
  3. Lv, X; Wang, X (July 2013). "The role of interleukin-9 in lymphoma.". Leukemia & Lymphoma 54 (7): 1367–72. PMID 23127115. doi:10.3109/10428194.2012.745072. 
  4. Pan, HF; Leng, RX; Li, XP; Zheng, SG; Ye, DQ (December 2013). "Targeting T-helper 9 cells and interleukin-9 in autoimmune diseases.". Cytokine & Growth Factor Reviews 24 (6): 515–22. PMID 25215394. doi:10.1016/j.cytogfr.2013.09.001. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.