FANDOM


Interleukin-12α
1F45 - IL12A

Synonyms

Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12A, IL-12 subunit p35, NK cell stimulatory factor chain 1

PDB

Search for UniProt ID P29459.

Example IDs
1F45 (RCSB, PDBe; X-ray),[1] 3HMX (RCSB, PDBe; X-ray)[2]

Proteopedia

N/A

Jmol applet of 1F45

1F45.

No. of amino acids

197

FASTA

Sequence
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

MeSH

C508858

UniProt

P29459

Entrez

3592


Interleukin-12β
1F45 - IL12B

Synonyms

Cytotoxic lymphocyte maturation factor 40 kDa subunit (CLMF p40), IL-12B, IL-12 subunit p40, NK cell stimulatory factor chain 2, NKSF2

PDB

Search for UniProt ID P29460.

Example IDs
1F45 (RCSB, PDBe; X-ray),[1] 3HMX (RCSB, PDBe; X-ray)

Proteopedia

N/A

Jmol applet of 1F45

1F45.

No. of amino acids

306

FASTA

Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

MeSH

C500879

UniProt

P29460

Entrez

3593

Interleukin-12 (IL-12) much like IL-1 comes in two major flavours: IL-12α and IL-12β. They act as growth factors for activated T and NK cells, enhance the lytic activity of NK/LAK cells, and stimulate the production of interferon-gamma by resting peripheral blood mononucleated cells (lymphocytes, macrophages and monocytes).[3] IL-12β is also required for the production of IL-23 (which it forms after combining with IL-23A).[3] IL-23 activates the JAK-STAT pathway and stimulates memory T-cells and the production of pro-inflammatory cytokines.[3] IL-12 also suppresses tumour growth, spread and induces apoptosis in these cells, recombinant IL-12 (edodekin alfa) has been under development for the treatment of cancers and infections (including mycobacterial ones like tuberculosis and viral ones) but results have been disappointing.[4][5][6] A monoclonal antibody against IL-12/23 has been under development for the treatment of autoimmune disorders.[7]



External linksEdit

Reference listEdit

  1. 1.0 1.1 Yoon, C; Johnston, SC; Tang, J; Stahl, M; Tobin, JF; Somers, WS (17 July 2000). "Charged residues dominate a unique interlocking topography in the heterodimeric cytokine interleukin-12.". The EMBO Journal 19 (14): 3530–41. PMC 313992. PMID 10899108. doi:10.1093/emboj/19.14.3530. 
  2. Unpublished data from Luo, J; Wu, SJ; Lacy, ER; Orlovsky, Y; Baker, A; Teplyakov, A; Obmolova, G; Heavner, GA; Richter, HT; Benson, J. "Structural Basis For Specificity of Ustekinumab Binding to the p40 Subunit of IL-12 and IL-23". doi:10.2210/pdb3hmx/pdb.
  3. 3.0 3.1 3.2 "Interleukin-12 subunit beta". UniProt. UniProt Consortium. 29 October 2014. 
  4. Méndez-Samperio, P (May 2010). "Role of interleukin-12 family cytokines in the cellular response to mycobacterial disease.". International Journal of Infectious Diseases 14 (5): e366–71. PMID 19762261. doi:10.1016/j.ijid.2009.06.022. 
  5. Wang, Y; Fan, KT; Li, JM; Waller, EK (1 January 2012). "The regulation and activity of interleukin-12.". Frontiers in Bioscience 4: 888–99. PMID 22202097. 
  6. Tugues, S; Burkhard, SH; Ohs, I; Vrohlings, M; Nussbaum, K; Vom Berg, J; Kulig, P; Becher, B (5 September 2014). "New insights into IL-12-mediated tumor suppression.". Cell Death and Differentiation. PMID 25190142. doi:10.1038/cdd.2014.134. 
  7. Benson, JM; Peritt, D; Scallon, BJ; Heavner, GA; Shealy, DJ; Giles-Komar, JM; Mascelli, MA (November-December 2011). "Discovery and mechanism of ustekinumab: a human monoclonal antibody targeting interleukin-12 and interleukin-23 for treatment of immune-mediated disorders.". mAbs 3 (6): 535–45. PMC 3242840. PMID 22123062. doi:10.4161/mabs.3.6.17815.  Check date values in: |date= (help)

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.