FANDOM


Interleukin-11
4MHL

Synonyms

IL-11, adipogenesis inhibitory factor (AGIF)

PDB

Search for UniProt ID P20809.

Example IDs
4MHL (RCSB, PDBe; X-ray)[1]

Proteopedia

N/A

Jmol applet of 4MHL

[1]

No. of amino acids

178

FASTA

Sequence
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

MeSH

D017370

UniProt

P20809

Entrez

3589

Interleukin-11 is an interleukin that promotes the proliferation of haematopoietic stem cells and megakaryocyte progenitor cells, also stimulates the maturation of megakaryocytes (hence increasing platelet production) and inhibits the production of adipocytes (fat cells).[2] It is also required embryo implantation, hence also required for conception.[3]

Recombinant human IL-11 (oprelvekin) is used to treat and prevent thrombocytopenia.[4]


External linksEdit

Reference listEdit

  1. Putoczki, TL; Dobson, RC; Griffin, MD (September 2014). "The structure of human interleukin-11 reveals receptor-binding site features and structural differences from interleukin-6.". Acta Crystallographica. Section D, Biological Crystallography 70 (Pt 9): 2277–85. PMID 25195742. doi:10.1107/S1399004714012267. 
  2. "Interleukin-11". Medical Subject Headings. Bethesda, USA: U.S. National Library of Medicine. 2011. Retrieved 5 November 2014. 
  3. Dimitriadis, E; Menkhorst, E (March 2011). "New generation contraceptives: interleukin 11 family cytokines as non-steroidal contraceptive targets.". Journal of Reproductive Immunology 88 (2): 233–9. PMID 21237515. doi:10.1016/j.jri.2010.12.002. 
  4. Sitaraman, SV; Gewirtz, AT (October 2001). "Oprelvekin. Genetics Institute.". Current Opinion in Investigational Drugs 2 (10): 1395–400. PMID 11890354. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.