FANDOM


Interleukin-1α
300px 2ILAw

Synonyms

Haematopoietin-1

PDB

Search for UniProt ID P01583.

Example IDs
2ILA (X-ray crystallography)[1]

Proteopedia

N/A

Jmol applet of 2ILA

2ILA.

No. of amino acids

159

FASTA

Sequence
SFLSNVKYNFMRIIKYEFILNDALNQSIIRANAQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

MeSH

D053582

UniProt

P01583

Entrez

3552

Interleukin-1β
300px 9ILB

Synonyms

Catabolin

PDB

Search for UniProt ID P01584.

Example IDs
9ILB (X-ray crystallography)[2]

Proteopedia

N/A

Jmol applet of 9ILB

9ILB.

No. of amino acids

153

FASTA

Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

MeSH

D053583

UniProt

P01584

Entrez

3553

Interleukin-1 (IL-1) is secreted by activated macrophages, amongst other cells, and has pro-inflammatory effects; it potentiates T-cell responses to antigens and mitogens and activates these cells.[3] It also triggers fever.[4]:790[5] It can refer to two distinct proteins: IL-1α and IL-1β. IL-1α is secreted active, whereas IL-1β needs to be activated by caspase-1.[6][7] They promote the production of prostaglandins.[8] IL-1 antagonists (e.g., anikinra) are used medically to treat rheumatoid arthritis.[9]


Further informationEdit

Reference listEdit

  1. Graves, BJ; Hatada, MH; Hendrickson, WA; Miller, JK; Madison, VS; Satow, Y (20 March 1990). "Structure of interleukin 1 alpha at 2.7-A resolution.". Biochemistry 29 (11): 2679–84. PMID 2346741. doi:10.1021/bi00463a009. 
  2. Yu, B; Blaber, M; Gronenborn, AM; Clore, GM; Caspar, DL (5 January 1999). "Disordered water within a hydrophobic protein cavity visualized by x-ray crystallography.". Proceedings of the National Academy of Sciences of the United States of America 96 (1): 103–8. PMID 9874779. doi:10.1073/pnas.96.1.103. 
  3. Weber, A; Wasiliew, P; Kracht, M (January 2010). "Interleukin-1 (IL-1) pathway". Science Signaling 3 (105): cm1. PMID 20086235. doi:10.1126/scisignal.3105cm1. 
  4. Cite error: Invalid <ref> tag; no text was provided for refs named Marieb
  5. "Interleukin-1". Medical Subject Headings. Bethesda, USA: U.S. National Library of Medicine. 2011. Retrieved 2 November 2014. 
  6. "Interleukin-1alpha". Medical Subject Headings. Bethesda, USA: U.S. National Library of Medicine. 2011. Retrieved 2 November 2014. 
  7. "Interleukin-1beta". Medical Subject Headings. Bethesda, USA: U.S. National Library of Medicine. 2011. Retrieved 2 November 2014. 
  8. "IL-1A - Interleukin-1 alpha precursor". UniProt. UniProt Consortium. 29 October 2014. Retrieved 4 November 2014. 
  9. Dinarello, CA (2009). "Immunological and Inflammatory Functions of the Interleukin-1 Family". Annual Review of Immunology 27 (1): 519–550. PMID 19302047. doi:10.1146/annurev.immunol.021908.132612. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.