FANDOM


Erythropoietin
1BUY

Synonyms

EPO, Epoetin (recombinant EPO for medicinal use)

PDB

Search for UniProt ID P01588.

Example IDs

Proteopedia

N/A

Jmol applet of 1BUY

[1]

No. of amino acids

166

FASTA

Sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

MeSH

D004921

UniProt

P01588

Entrez

2056

Erythropoietin is a growth factor and cytokine produced by the kidneys (and liver in a fetus) that stimulates the development of red blood cells in the bone marrow, increasing its production.[1]

External linksEdit

Reference listEdit

  1. "Erythropoietin". Medical Subject Headings. Bethesda, MD: U.S. National Library of Medicine. 2015. 

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.