FANDOM


3N8V

Synonyms

Prostaglandin H2 Synthase 1, PTGS1

PDB

Search for UniProt ID P23219.

Example IDs

Proteopedia

[1]

Jmol applet of 3N8V

3N8V.

Residues

576

FASTA

Sequence
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

EC number

1.14.99.1

Entrez

5742

MeSH

D051545
Review search.

UniProt

P23219

Cyclooxygenase 1 mediates the synthesis of various home-keeping prostaglandins like those required for the maintenance of stomach mucosa (which is what protects the stomach from its stomach acid) and platelet aggregation (which is required for blood clotting).[1]

External linksEdit

Reference listEdit

  1. Süleyman, H; Demircan, B; Karagöz, Y (May-June 2007). "Anti-inflammatory and side effects of cyclooxygenase inhibitors." (PDF). Pharmacological Reports 59 (3): 247–58. PMID 17652824.  Check date values in: |date= (help)

Ad blocker interference detected!


Wikia is a free-to-use site that makes money from advertising. We have a modified experience for viewers using ad blockers

Wikia is not accessible if you’ve made further modifications. Remove the custom ad blocker rule(s) and the page will load as expected.